PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G04840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 524aa    MW: 54394.2 Da    PI: 5.5211
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G04840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA529.3e-17433466134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      Cs+Cg+++Tp+WR gp+g+ tLCnaCG++ +  +
  LPERR11G04840.1 433 CSHCGSSETPQWRMGPNGPGTLCNACGIRCKMGR 466
                      *****************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.624427464IPR000679Zinc finger, GATA-type
SMARTSM004019.5E-16427477IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.75E-13430490No hitNo description
Gene3DG3DSA:3.30.50.101.0E-13431465IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.45E-15433488No hitNo description
PROSITE patternPS003440433458IPR000679Zinc finger, GATA-type
PfamPF003201.2E-14433467IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MSYAPANKAA AAAAAAGTYA GMRNPPTPSS SFLDDLAVDG DCDGDDVPLD SSYLFEGLSC  60
PDDPLDQVIG PVDTAAFAHG FFDSFGVDFS PSPPRDTTPA VADDGDFTSD MLMEAVGLGA  120
CATESPLYGG GERGEDETGS KLAAAAEDME AEPSLDVKPV AGFGAGVGIG IGIGGGGGGL  180
SAAPPEFPLE NNNPIPSPYA GFDARTAWPA LGGAGMSAPP PGFLSDNRRP LIPSPDDVTF  240
DGAMTVVRAG ERGMTTQNRL PTLPLVRCSA NPIATAPPGT PFQWDHAAAP TSGVSTTPSD  300
SSTSSPSGSV TPRIAAPYPC PTGPRKPRRR SGWSLICPLD AVPVAASRRG KTINQIINAP  360
RIFTTSISRD SGGDNSKASF VSSNSSSSDG AKEMSLSASM NPSSSNGDGG GGSYRRRVVG  420
RQRNRQVRRD RRCSHCGSSE TPQWRMGPNG PGTLCNACGI RCKMGRLVPE YRPSTSPSFN  480
SDEHSNRHRK VMKIREKNTC NSGGEHSNSR LSVIETTTTY GELR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9XPX00.0A0A0D9XPX0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA034366-PA2e-76(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127772434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.13e-26GATA transcription factor 4